PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G37780.1
Common NameATMYB87, MYB87
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 305aa    MW: 34965.9 Da    PI: 5.9482
Description myb domain protein 87
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G37780.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.73.6e-151462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W+teEd  l+ +++++G+g +W + ++++g +R++k+c++rw++yl
      AT4G37780.1 14 KGPWSTEEDAVLKSYIEKHGTGnNWISLPQRIGIKRCGKSCRLRWLNYL 62
                     79*******************************55************97 PP

2Myb_DNA-binding36.61e-1169111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +T eEd ++  +    G++ W+ Ia+ ++ gRt++++k++w++
      AT4G37780.1  69 GGFTDEEDYIICSLYITIGSR-WSIIASQLP-GRTDNDIKNYWNT 111
                      569******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.932966IPR017930Myb domain
SuperFamilySSF466892.21E-2612109IPR009057Homeodomain-like
SMARTSM007171.1E-111364IPR001005SANT/Myb domain
PfamPF002496.0E-151462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-231569IPR009057Homeodomain-like
CDDcd001671.17E-81662No hitNo description
SMARTSM007171.2E-1067115IPR001005SANT/Myb domain
PROSITE profilePS5129415.22167117IPR017930Myb domain
PfamPF002494.4E-1069111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.0E-2370117IPR009057Homeodomain-like
CDDcd001673.24E-771113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0030154Biological Processcell differentiation
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000036anatomyleaf vascular system
PO:0000052anatomypetiole vascular system
PO:0000056anatomyflower bud
PO:0000115anatomysocket cell
PO:0000332anatomyepidermal pavement cell
PO:0003011anatomyroot vascular system
PO:0004536anatomyfruit pedicel
PO:0004707anatomyfruit dehiscence zone
PO:0005660anatomyhydathode
PO:0005679anatomyepidermis
PO:0006016anatomyleaf epidermis
PO:0006040anatomysepal epidermis
PO:0006325anatomyinflorescence node
PO:0009005anatomyroot
PO:0009015anatomyportion of vascular tissue
PO:0009025anatomyvascular leaf
PO:0009046anatomyflower
PO:0020030anatomycotyledon
PO:0007611developmental stagepetal differentiation and expansion stage
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MGRAPCCDKM AVKKGPWSTE EDAVLKSYIE KHGTGNNWIS LPQRIGIKRC GKSCRLRWLN  60
YLRPNLKHGG FTDEEDYIIC SLYITIGSRW SIIASQLPGR TDNDIKNYWN TRLKKKLLSK  120
QGKAFHQQLN VKFERGTTSS SSSQNQIQIF HDENTKSNQT LYNQVVDPSM RAFAMEEQSM  180
IKNQILEPFS WEPNKVLFDV DYDAAASSYH HHASPSLNSM SSTSSIGTNN SSLQMSHYTV  240
NHNDHDQPDM FFMDGFENFQ AELFDEIANN NTVENGFDGT EILINNNYLD HDISSFIDYP  300
LYDNE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-24141177108B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.109230.0root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1865172310.0
Genevisible253067_at0.0
Expression AtlasAT4G37780-
AtGenExpressAT4G37780-
ATTED-IIAT4G37780-
Functional Description ? help Back to Top
Source Description
TAIR"encoded by the Myb-like transcription factor MYB87, regulates axillary meristem formation, expressed throughout the plant. Member of the R2R3 factor gene family."
Function -- GeneRIF ? help Back to Top
  1. Data suggest a model in which combinatorial interactions with co-activators enable R2R3 MYB factors with very similar DNA binding preferences to discriminate between target genes in vivo.
    [PMID: 15347654]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G37780.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G37780
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5196140.0AY519614.1 Arabidopsis thaliana MYB transcription factor (At4g37780) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_195492.20.0myb domain protein 87
TrEMBLF4JSU00.0F4JSU0_ARATH; Myb domain protein 87
STRINGAT4G37780.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Hernandez JM, et al.
    Different mechanisms participate in the R-dependent activity of the R2R3 MYB transcription factor C1.
    J. Biol. Chem., 2004. 279(46): p. 48205-13
    [PMID:15347654]
  4. Müller D,Schmitz G,Theres K
    Blind homologous R2R3 Myb genes control the pattern of lateral meristem initiation in Arabidopsis.
    Plant Cell, 2006. 18(3): p. 586-97
    [PMID:16461581]
  5. Hall AE,Kettler GC,Preuss D
    Dynamic evolution at pericentromeres.
    Genome Res., 2006. 16(3): p. 355-64
    [PMID:16461884]
  6. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  7. Ma S,Gong Q,Bohnert HJ
    Dissecting salt stress pathways.
    J. Exp. Bot., 2006. 57(5): p. 1097-107
    [PMID:16510518]
  8. Kranz HD, et al.
    Towards functional characterisation of the members of the R2R3-MYB gene family from Arabidopsis thaliana.
    Plant J., 1998. 16(2): p. 263-76
    [PMID:9839469]